PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G069370_P01
Common NameZEAMMB73_580475, Zm.131337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 199aa    MW: 22894.4 Da    PI: 8.4853
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G069370_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.58.8e-241056248
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                       rien   rqvtf+kRr g+lKKA ELSvLCda + vi++s++gk+y+
  GRMZM2G069370_P01 10 RIENPVHRQVTFCKRRMGLLKKARELSVLCDAAIGVIVISPHGKIYD 56
                       8********************************************97 PP

2K-box56.51.2e-1979172698
              K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                        g+s +++++++ +qe+  L  ei+ Lq+  R + Ge d++ ++l eLq Le++Le   ++iRs+K++++ ++i+ l++ke  lq  n  L++
  GRMZM2G069370_P01  79 GESSNHNETQTIKQEVLALTHEIDLLQKGFRYMHGEnDINHMNLVELQTLENNLEMWANNIRSQKMQIISREIDMLRNKEAILQAVNGVLQE 170
                        56678899***************************978**************************************************9999 PP

              K-box  97 kl 98 
                        ++
  GRMZM2G069370_P01 171 RI 172
                        87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.16161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-26173IPR002100Transcription factor, MADS-box
CDDcd002651.28E-35278No hitNo description
PRINTSPR004042.4E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.4E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-243859IPR002100Transcription factor, MADS-box
PfamPF014868.3E-2481172IPR002487Transcription factor, K-box
PROSITE profilePS5129712.67487179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025541anatomybundle sheath cell
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KARELSVLCD AAIGVIVISP HGKIYDLATN  60
GNMQGLIERY RRACSEMHGE SSNHNETQTI KQEVLALTHE IDLLQKGFRY MHGENDINHM  120
NLVELQTLEN NLEMWANNIR SQKMQIISRE IDMLRNKEAI LQAVNGVLQE RIIEQNGILN  180
FSGTAMTPSQ LTMESNYYL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G069370
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G069370_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761310.0EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001145530.11e-146uncharacterized protein LOC100278959
SwissprotA2YQK91e-71MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-71MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLK7UIP11e-147K7UIP1_MAIZE; Putative MADS-box transcription factor family protein
STRINGGRMZM2G069370_P011e-146(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-57AGAMOUS-like 12